{"product_id":"proteintech-31543-1-ap","title":"Proteintech, 31543-1-AP, PPEF2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPEF2 (31543-1-AP) by Proteintech is a Polyclonal antibody targeting PPEF2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n31543-1-AP targets PPEF2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, rat kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPprotein phosphatase with EF-hand domain 2 (PPEF2), also known as PPP7CB, is a member of the serine\/threonine protein phosphatase with EF-hand motif family. PPEF2 can dephosphorylate ubiquitin and suppress PINK1-dependent mitophagy. PPEF2 functions to suppress mitochondrial quality control on a cellular level through dephosphorylation of p-S65 ubiquitin. PPEF2 exists 2 isoforms produced by alternative splicing with a molecular weight of 86 kDa (PPEF-2(L)) and 69 kDa (PPEF-2(S)).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35922 Product name: Recombinant human PPEF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 294-442 aa of NM_006239 Sequence: GVSDITDLELLDKIERSKIVSTMRCKTRQKSEKQMEEKRRANQKSSAQGPIPWFLPESRSLPSSPLRLGSYKAQKTSRSSSIPCSGSLDGRELSRQVRSSVELELERCRQQAGLLVTGEKEEPSRSASEADSEAGELRKPTQEEWRQVV Predict reactive species\nFull Name: protein phosphatase, EF-hand calcium binding domain 2\nCalculated Molecular Weight: 86kDa\nObserved Molecular Weight: 69 kDa\nGenBank Accession Number: NM_006239\nGene Symbol: PPEF2\nGene ID (NCBI): 5470\nRRID: AB_3670032\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O14830\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887769473193,"sku":"31543-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31543-1-ap","provider":"Iright","version":"1.0","type":"link"}