{"product_id":"proteintech-31559-1-ap","title":"Proteintech, 31559-1-AP, NUDT4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NUDT4 (31559-1-AP) by Proteintech is a Polyclonal antibody targeting NUDT4 in WB, ELISA applications with reactivity to human, mouse, rat samples\n31559-1-AP targets NUDT4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNUDT4 also known as DIPP2, NUDT4B, belongs to the Nudix hydrolase family. NUDT4 is an inositol diphosphate polyphosphate phosphatase (DIPP2) whose main function is to catalyze hydrolysis reactions of nucleotide derivatives and to regulate the metabolism of inositol diphosphate polyphosphates.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34852 Product name: Recombinant human NUDT4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-181 aa of BC012069 Sequence: LQCHKPVHAEYLEKLKLGCSPANGNSTVPSLPDNNALFVTAAQTSGLPSSVR Predict reactive species\nFull Name: nudix (nucleoside diphosphate linked moiety X)-type motif 4\nCalculated Molecular Weight: 181 aa, 20 kDa\nObserved Molecular Weight: 20 kDa\nGenBank Accession Number: BC012069\nGene Symbol: NUDT4\nGene ID (NCBI): 11163\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: A0A024RBG1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887744340137,"sku":"31559-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31559-1-ap","provider":"Iright","version":"1.0","type":"link"}