{"product_id":"proteintech-31625-1-ap","title":"Proteintech, 31625-1-AP, TMEM164 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM164 (31625-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM164 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n31625-1-AP targets TMEM164 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTMEM164 (Transmembrane Protein 164) is a membrane protein with significant roles in various biological processes, including lipid metabolism, neuroprotection, and cancer regulation. In non-small cell lung cancer (NSCLC), TMEM164 promotes ferroptosis by mediating autophagy, leading to the degradation of ferritin, GPX4, and lipid droplets, which facilitates iron accumulation and lipid peroxidation (PMID: 39798196). In neurodegenerative diseases, TMEM164 overexpression via gene therapy shows promise in reducing neurotoxic reactive astrocyte activation and alleviating disease symptoms (PMID: 37679556).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag34317 Product name: Recombinant human TMEM164 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-38 aa of BC085605 Sequence: MSRYSYQSLLDWLYGGVDPSFAGNGGPDCAAFLSWQQR Predict reactive species\nFull Name: transmembrane protein 164\nGenBank Accession Number: BC085605\nGene Symbol: TMEM164\nGene ID (NCBI): 84187\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q5U3C3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887830847657,"sku":"31625-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31625-1-ap","provider":"Iright","version":"1.0","type":"link"}