{"product_id":"proteintech-31674-1-ap","title":"Proteintech, 31674-1-AP, LYRM2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LYRM2 (31674-1-AP) by Proteintech is a Polyclonal antibody targeting LYRM2 in IP, ELISA applications with reactivity to human samples\n31674-1-AP targets LYRM2 in IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: HT-29 cells, COLO 320 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLYR motif containing 2 (LYRM2) is an evolutionarily conserved gene which belongs to LYR (leucine-tyrosine-arginine) motif proteins (LYRMs) family. LYRM2 is the one of the top ten most significantly upregulated differentially expressed genes in trabecular osteocytes between osteoporosis and normal controls (PMID: 34252604), which is up-regulated in colorectal cancer and promotes tumor growth both in vivo and in vitro. LYRM2 locates in the mitochondrial inner membrane and matrix (PMID: 31004700).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36366 Product name: Recombinant human LYRM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-88 aa of BC009782 Sequence: QQVLLLYRRILQTIRQVPNDSDRKYLKDWAREEFRRNKSATEEDTIRMMITQGNMQLKELEKTLALAKS Predict reactive species\nFull Name: LYR motif containing 2\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC009782\nGene Symbol: LYRM2\nGene ID (NCBI): 57226\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9NU23\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887710228649,"sku":"31674-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31674-1-ap","provider":"Iright","version":"1.0","type":"link"}