{"product_id":"proteintech-31686-1-ap","title":"Proteintech, 31686-1-AP, ALAD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ALAD (31686-1-AP) by Proteintech is a Polyclonal antibody targeting ALAD in WB, ELISA applications with reactivity to human samples\n31686-1-AP targets ALAD in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDelta-aminolevulinic acid dehydratase (ALAD) is also named as Porphobilinogen synthase. ALAD, encoded by the moonlighting gene ALAD, not only participates in the second step of heme biosynthesis, but also inhibits the 26S proteasome (PMID: 35318110). ALAD is involved in tumor progression. For example, ALAD2 allele (ALAD polymorphism) is related to an increased risk for meningioma, and downregulation of ALAD is related to poor prognosis of patients with breast cancer (PMID: 16140629, PMID: 28403546).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35649 Product name: Recombinant human ALAD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 151-330 aa of NM_000031.5 Sequence: AEVALAYAKAGCQVVAPSDMMDGRVEAIKEALMAHGLGNRVSVMSYSAKFASCFYGPFRDAAKSSPAFGDRRCYQLPPGARGLALRAVDRDVREGADMLMVKPGMPYLDIVREVKDKHPDLPLAVYHVSGEFAMLWHGAQAGAFDLKAAVLEAMTAFRRAGADIIITYYTPQLLQWLKEE Predict reactive species\nFull Name: aminolevulinate, delta-, dehydratase\nCalculated Molecular Weight: 36kDa，330aa\nObserved Molecular Weight: 36-39 kDa\nGenBank Accession Number: NM_000031.5\nGene Symbol: ALAD\nGene ID (NCBI): 210\nRRID: AB_3670079\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P13716\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869633826985,"sku":"31686-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31686-1-ap","provider":"Iright","version":"1.0","type":"link"}