{"product_id":"proteintech-31697-1-ap","title":"Proteintech, 31697-1-AP, ATP8A2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATP8A2 (31697-1-AP) by Proteintech is a Polyclonal antibody targeting ATP8A2 in IHC, IP, ELISA applications with reactivity to human, mouse samples\n31697-1-AP targets ATP8A2 in IHC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: mouse testis tissue\nPositive IHC detected in: mouse brain tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP8A2 is also known as ATPIB. ATP8A2 is a member of the P4‐ATPase subfamily of P‐type ATPases that actively flips phosphatidylserine (PS) and phosphatidylethanolamine (PE) across membranes to generate and maintain transmembrane phospholipid asymmetry, a property important in such cellular processes as vesicle trafficking, apoptosis, cytokinesis, neuron survival, blood coagulation, and phagocytosis. ATP8A2 consists of an N‐domain involved in binding ATP, a P‐domain that undergoes phosphorylation, an A‐domain that functions in the dephosphorylation of the phosphorylated intermediate, and an M‐domain consisting of 10 transmembrane segments that comprise the pathway for translocation of the lipid across the membrane. ATP8A2 is highly expressed in the brain, spinal cord, testis, and retina (PMID: 33565221, PMID: 33766557, PMID: 37635783).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36276 Product name: Recombinant human ATP8A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1085-1188 aa of NM_001313741 Sequence: EDVAWRAAKHTCKKTLLEEVQELETKSRVLGKAVLRDSNGKRLNERDRLIKRLGRKTPPTLFRGSSLQQGVPHGYAFSQEEHGAVSQEEVIRAYDTTKKKSRKK Predict reactive species\nFull Name: ATPase, aminophospholipid transporter-like, class I, type 8A, member 2\nCalculated Molecular Weight: 133kDa\nObserved Molecular Weight: 129 kDa\nGenBank Accession Number: NM_001313741\nGene Symbol: ATP8A2\nGene ID (NCBI): 51761\nRRID: AB_3670083\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9NTI2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885126865065,"sku":"31697-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31697-1-ap","provider":"Iright","version":"1.0","type":"link"}