{"product_id":"proteintech-31699-1-ap","title":"Proteintech, 31699-1-AP, IRX1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IRX1 (31699-1-AP) by Proteintech is a Polyclonal antibody targeting IRX1 in WB, ELISA applications with reactivity to human, mouse samples\n31699-1-AP targets IRX1 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells, C2C12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIroquois homeobox protein 1 (IRX1) is a member of the Iroquois homeobox family of transcription factors which plays a crucial role in embryonic development. IRX1 has been previously shown to function as a potential tumor suppressor in rheumatoid arthritis (RA), congenital heart disease (CHD), and tumors, such as gastric cancer (GC) and osteosarcoma (PMID: 25822025, PMID:  31640472). The molecular weight of IRX1 is 50 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36597 Product name: Recombinant human IRX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 190-300 aa of BC166635 Sequence: KVTWGARSKDQEDGALFGSDTEGDPEKAEDDEEIDLESIDIDKIDEHDGDQSNEDDEDKAEAPHAPAAPSALARDQGSPLAAADVLKPQDSPLGLAKEAPEPGSTRLLSPG Predict reactive species\nFull Name: iroquois homeobox 1\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC166635\nGene Symbol: IRX1\nGene ID (NCBI): 79192\nRRID: AB_3670085\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P78414\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887686799529,"sku":"31699-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31699-1-ap","provider":"Iright","version":"1.0","type":"link"}