{"product_id":"proteintech-31710-1-ap","title":"Proteintech, 31710-1-AP, CAB39 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CAB39 (31710-1-AP) by Proteintech is a Polyclonal antibody targeting CAB39 in WB, ELISA applications with reactivity to human, rat samples\n31710-1-AP targets CAB39 in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  C6 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCAB39 (Calcium-binding protein 39), also called MO25, is a component of the complex that binds and activates STK11\/LKB1. It is required to stabilize the interaction between CAB39\/MO25 (CAB39\/MO25alpha or CAB39L\/MO25beta) and STK11\/LKB1 (PMID: 19892943).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36153 Product name: Recombinant human CAB39 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-51 aa of BC020570 Sequence: MPFPFGKSHKSPADIVKNLKESMAVLEKQDISDKKAEKATEEVSKNLVAMK Predict reactive species\nFull Name: calcium binding protein 39\nObserved Molecular Weight: 39-40 kDa\nGenBank Accession Number: BC020570\nGene Symbol: CAB39\nGene ID (NCBI): 51719\nRRID: AB_3670091\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9Y376\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885720293545,"sku":"31710-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31710-1-ap","provider":"Iright","version":"1.0","type":"link"}