{"product_id":"proteintech-31712-1-ap","title":"Proteintech, 31712-1-AP, SHROOM4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SHROOM4 (31712-1-AP) by Proteintech is a Polyclonal antibody targeting SHROOM4 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n31712-1-AP targets SHROOM4 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human placenta tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HUVEC cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Shroom-related gene SHROOM4 (formerly called KIAA1202) has also been implicated in neural development, as mutations in this gene are associated with human X-linked mental retardation. SHROOM4 is expressed in a wide range of tissue types during mouse development, including the vascular endothelium of the lung and the polarized epithelium of the neural tube and kidney.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36423 Product name: Recombinant human SHROOM4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1170-1320 aa of BC151240 Sequence: GSCALNPEEVLEQPQPLSFGHLEGSRQGSQSVPAEQESFALHSSDFLPPIRGHLGSQPEQAQPPCYYGIGGLWRTSGQEATESAKQEFQHFSPPSGAPGIPTSYSAYYNISVAKAELLNKLKDQPEMAEIGLGEEEVDHELAQKKIQLIES Predict reactive species\nFull Name: shroom family member 4\nGenBank Accession Number: BC151240\nGene Symbol: SHROOM4\nGene ID (NCBI): 57477\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9ULL8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887801585833,"sku":"31712-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31712-1-ap","provider":"Iright","version":"1.0","type":"link"}