{"product_id":"proteintech-31739-1-ap","title":"Proteintech, 31739-1-AP, NT5DC2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NT5DC2 (31739-1-AP) by Proteintech is a Polyclonal antibody targeting NT5DC2 in WB, ELISA applications with reactivity to human samples\n31739-1-AP targets NT5DC2 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NCI-H1299 cells, SW480 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\n5'-Nucleotidase domain containing 2 (NT5DC2) is a member of the NT5DC family and contains a haloacid dehalogenase motif localized in the N-terminus of these proteins (PMID: 32962856). NT5DC2 is associated with attention-deficit\/hyperactivity disorder and bipolar disorder. NT5DC2 has been shown to interact with and stabilize Fyn, a Src family proto-oncogene, and plays a role in regulating glioblastoma progression. NT5DC2 promotes tumor cell proliferation by stabilizing EGFR in hepatocellular carcinoma (PMID: 32382041).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35015 Product name: Recombinant human NT5DC2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 195-265 aa of NM_022908 Sequence: LLSCVVDYFLGHSLEFDQAHLYKDVTDAIRDVHVKGLMYQWIEQDMEKYILRGDETFAVLSRLVAHGKQLF Predict reactive species\nFull Name: 5'-nucleotidase domain containing 2\nCalculated Molecular Weight: 61 kDa\nObserved Molecular Weight: 60-65 kDa\nGenBank Accession Number: NM_022908\nGene Symbol: NT5DC2\nGene ID (NCBI): 64943\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9H857\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887743324329,"sku":"31739-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31739-1-ap","provider":"Iright","version":"1.0","type":"link"}