{"product_id":"proteintech-31765-1-ap","title":"Proteintech, 31765-1-AP, TFPI Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TFPI (31765-1-AP) by Proteintech is a Polyclonal antibody targeting TFPI in WB, IF\/ICC, ELISA applications with reactivity to human samples\n31765-1-AP targets TFPI in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTissue factor pathway inhibitor (TFPI) is an anticoagulant protein produced primarily by the endothelium and megakaryocytes and alternative mRNA splicing generates two main forms, TFPIα and TFPIβ (PMID: 26149025, PMID: 16246254). TFPIα is a soluble form of TFPI. It is a ~46 kDa glycoprotein and consists of an acidic N-terminal regionfollowed by three tandem, Kunitz-type protease inhibitor domains and a basic C-terminal region. Based on protein mass, TFPIβ (28 kDa) is considerably smaller than TFPIα (36 kDa), but both migrate with the same apparent molecular mass (46 kDa) on sodium dodecylsulfatepolyacrylamide gel electrophoresis (SDS-PAGE), suggesting a difference in post-translational modifications (PMID: 16246254). TFPI associated with LDLis 34 kDa and lacks a substantial portion of the carboxy terminus including at least a portion of the third Kunitz domain. TFPI associated with HDL is 41 kDa and is in part a mixed disulphide complex between TFPI and apolipoprotein All (PMID: 8979119). TFPI exerts its anticoagulant effects by inhibiting TF-FVIIa in a manner that is dependent on its inhibition of factor  Xa (FXa) (PMID: 2927510).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg0855 Product name: Recombinant Human TFPI protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-10*His Domain: 29-282 aa of NM_006287.6 Sequence: DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK Predict reactive species\nFull Name: tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor)\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 35-40 kDa\nGenBank Accession Number: NM_006287.6\nGene Symbol: TFPI\nGene ID (NCBI): 7035\nRRID: AB_3670106\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P10646-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887826522281,"sku":"31765-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31765-1-ap","provider":"Iright","version":"1.0","type":"link"}