{"product_id":"proteintech-31777-1-ap","title":"Proteintech, 31777-1-AP, DRAM Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DRAM (31777-1-AP) by Proteintech is a Polyclonal antibody targeting DRAM in WB, ELISA applications with reactivity to human samples\n31777-1-AP targets DRAM in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HCT 116 cells, HeLa cells,  HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDamage-regulated autophagy modulator (DRAM) is a lysosomal membrane protein of autophagy that enriches in lung tissue and plays a central role in p53\/TP53-mediated apoptosis (PMID: 16839881), which increased autophagy flux by promoting lysosomal acidification and protease activation (PMID: 23696801). It has 238 amino acids and six hydrophobic transmembrane regions. Reports show DRAM to be downregulated in squamous cancers, indicating a selective pressure to lose DRAM during tumor development (PMID: 17102582). Overexpression of DRAM1 can promote mitophagy and enhance mitochondrial function (PMID: 31204316).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag33711 Product name: Recombinant human DRAM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 30-90 aa of BC018435 Sequence: AVLSGHVNPFLPYISDTGTTPPESGIFGFMINFSAFLGAATMYTRYKIVQKQNQTCYFSTP Predict reactive species\nFull Name: damage-regulated autophagy modulator\nCalculated Molecular Weight: 26 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC018435\nGene Symbol: DRAM\nGene ID (NCBI): 55332\nRRID: AB_3670110\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8N682\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887318913193,"sku":"31777-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31777-1-ap","provider":"Iright","version":"1.0","type":"link"}