{"product_id":"proteintech-31781-1-ap","title":"Proteintech, 31781-1-AP, GPR112 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR112 (31781-1-AP) by Proteintech is a Polyclonal antibody targeting GPR112 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n31781-1-AP targets GPR112 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGPR112 is a member of the adhesion G protein-coupled receptor (aGPCR) family. These receptors are characterized by a complex architecture and large size, mainly attributed to their N terminus, which contains a variety of domains involved in cell-cell and cell-matrix interactions. The function of GPR112 and other aGPCRs is closely related to key aspects of the development, architecture, and function of the nervous system. They are involved in neuronal migration, axon guidance, dendritogenesis, and synaptogenesis. Additionally, aGPCRs, including GPR112, have been implicated in the development of myelinating glial cells, which are crucial for proper neuronal signal propagation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36114 Product name: Recombinant human GPR112 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2400-2550 aa of NM_153834 Sequence: KWLLTNPTETAQTRCIKNEDGNATRFCSISINTGKSQWEKPKFKQCKLLQELPDKIVDLANITISDENAEDVAEHILNLINESPALGKEETKIIVSKISDISQCDEISMNLTHVMLQIINVVLEKQNNSASDLHEISNEILRIIERTGHKM Predict reactive species\nFull Name: G protein-coupled receptor 112\nCalculated Molecular Weight: 333kDa\nGenBank Accession Number: NM_153834\nGene Symbol: GPR112\nGene ID (NCBI): 139378\nRRID: AB_3670112\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8IZF6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887655702697,"sku":"31781-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31781-1-ap","provider":"Iright","version":"1.0","type":"link"}