{"product_id":"proteintech-31788-1-ap","title":"Proteintech, 31788-1-AP, TRBC1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRBC1 (31788-1-AP) by Proteintech is a Polyclonal antibody targeting TRBC1 in WB, ELISA applications with reactivity to human samples\n31788-1-AP targets TRBC1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HuT 78 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRBC1 (T-cell receptor beta constant 1) is a protein encoded by the TRBC1 gene. It constitutes one of the two beta-chain constant regions (TRBC1 and TRBC2) within the T-cell receptor (TCR) complex, which is essential for adaptive immune responses .\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35434 Product name: Recombinant human TRBC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-149 aa of M12888 Sequence: DLNKVFPPEVAVFEPSEAEISHTQKATLVCLATGFFPDHVELSWWVNGKEVHSGVSTDPQPLKEQPALNDSRYCLSSRLRVSATFWQNPRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRADCGFTSVSYQQGVLSATILYE Predict reactive species\nFull Name: T cell receptor beta constant 1\nCalculated Molecular Weight: 20 kDa\nObserved Molecular Weight: 30-40 kDa\nGenBank Accession Number: M12888\nGene Symbol: TRBC1\nGene ID (NCBI): 28639\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P01850\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887837728937,"sku":"31788-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31788-1-ap","provider":"Iright","version":"1.0","type":"link"}