{"product_id":"proteintech-31796-1-ap","title":"Proteintech, 31796-1-AP, LIAT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LIAT1 (31796-1-AP) by Proteintech is a Polyclonal antibody targeting LIAT1 in WB, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n31796-1-AP targets LIAT1 in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  mouse kidney tissue,  mouse liver tissue,  mouse lung tissue,  mouse spleen tissue\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLiat1 (Ligand of Ate1) is a protein of unknown function that was originally discovered through its interaction with arginyl tRNA protein transferase 1 (Ate1), a component of the Arg\/N-degron pathway of protein degradation.Liat1 participates in Liquid-liquid phase separation (LLPS), a process which enables the temporal and spatial regulation of important cellular processes such as RNA metbolism, genome organization, DNA repair, and transcription regulation. Liat1 interacts with itself, which means Liat1 can assemble into different species in nucleus or cytosol. Our WB is consistent with Arva A et al (PMID: 33443146).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37082 Product name: Recombinant human C17orf97 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-200 aa of BC141806 Sequence: GDDKHLSQSLKSQPLSSSFHDILSPCKERGPKPEHRQSKVEKKHLPSDSSTVSLPDFAEIENLANRINESLRWDGILADPEAEKERIRIYKLNRRKRYRCL Predict reactive species\nFull Name: chromosome 17 open reading frame 97\nObserved Molecular Weight: 20-70 kDa\nGenBank Accession Number: BC141806\nGene Symbol: C17orf97\nGene ID (NCBI): 400566\nRRID: AB_3670116\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6ZQX7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887703609513,"sku":"31796-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31796-1-ap","provider":"Iright","version":"1.0","type":"link"}