{"product_id":"proteintech-31849-1-ap","title":"Proteintech, 31849-1-AP, ACTG2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ACTG2 (31849-1-AP) by Proteintech is a Polyclonal antibody targeting ACTG2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n31849-1-AP targets ACTG2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, mouse skeletal muscle tissue,  HepG2 cells,  mouse stomach tissue,  rat skeletal muscle tissue\nPositive IHC detected in: mouse stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nActin gamma 2 (ACTG2, also known as ACT, ACTE, VSCM, ACTA3, ACTL3, and ACTSG) is a highly conserved protein involved in various types of cell motility and ubiquitously expressed in all eukaryotic cells. ACTG2 mutations would cause congenital distended bladder, microcolon, and intestinal hypoperistalsis (PMID: 24337657). It also has been reported that ACTG2 promotes hepatocellular carcinoma (HCC) migration and invasion through the Notch1 signaling pathway, which might serve as a new intervention target for the treatment of HCC (PMID: 28385530).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36024 Product name: Recombinant human ACTG2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC094877 Sequence: MCEEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPE Predict reactive species\nFull Name: actin, gamma 2, smooth muscle, enteric\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC094877\nGene Symbol: ACTG2\nGene ID (NCBI): 72\nRRID: AB_3670128\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P63267\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869801271465,"sku":"31849-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31849-1-ap","provider":"Iright","version":"1.0","type":"link"}