{"product_id":"proteintech-31850-1-ap","title":"Proteintech, 31850-1-AP, RBM27 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RBM27 (31850-1-AP) by Proteintech is a Polyclonal antibody targeting RBM27 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n31850-1-AP targets RBM27 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Hela cell,  jurkat cell,  K-562 cell\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRBM27 has been identified as a candidate autism gene, and is present in cytoplasmic and and nuclear speckles. RBM27 encodes a protein containing an RNA-Binding Motif, which confers its ability to bind RNA. Therefore, RBM27 is important in mRNA processing and  the turnover of nuclear polyadenylate (pA+) RNA.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35822 Product name: Recombinant human RBM27 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 680-815 aa of NM_018989 Sequence: TLQSSAQLLLQQQQTLSHLSQQHHHLPQHLHQQQVLVAQSAPSTVHGGIQKMMSKPQTSGAYVLNKVPVKHRLGHAGGNQSDASHLLNQSGGAGEDCQIFSTPGHPKMIYSSSNLKTPSKLCSGSKSHDVQEVLKK Predict reactive species\nFull Name: RNA binding motif protein 27\nCalculated Molecular Weight: 119 kDa\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: NM_018989\nGene Symbol: RBM27\nGene ID (NCBI): 54439\nRRID: AB_3670129\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9P2N5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887780221097,"sku":"31850-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31850-1-ap","provider":"Iright","version":"1.0","type":"link"}