{"product_id":"proteintech-31889-1-ap","title":"Proteintech, 31889-1-AP, CD3 epsilon Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD3 epsilon (31889-1-AP) by Proteintech is a Polyclonal antibody targeting CD3 epsilon in WB, IHC, ELISA applications with reactivity to rat samples\n31889-1-AP targets CD3 epsilon in WB, IHC, ELISA applications and shows reactivity with rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat thymus tissue\nPositive IHC detected in: rat spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD3 is a multimeric protein associated with the T-cell receptor (TCR) to form a complex involved in antigen recognition and signal transduction (PMID: 15885124). CD3 is composed of CD3γ, δ, ε, and ζ chains (PMID: 1826255). It is expressed by thymocytes in a developmentally regulated manner, T cells, and some NK cells (PMID: 3289580). The TCR recognizes antigens bound to major histocompatibility complex (MHC) molecules. TCR-mediated peptide-MHC recognition is transmitted to the CD3 complex, leading to the intracellular signal transduction (PMID: 11985657). This polyclonal antibody was raised against the epsilon chain of rat CD3 molecule.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg1450 Product name: Recombinant Rat CD3 epsilon protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-103 aa of NP_001101610.2 Sequence: IEDTVTDDGAQKQYEVSISGTSVELTCPLENEDNLKWEKNDKVLPDKNEKHLVLEDFSEVKDSGYYVCYTESSRKNTYLY Predict reactive species\nFull Name: CD3 molecule, epsilon polypeptide\nCalculated Molecular Weight: 22kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: NP_001101610.2\nGene Symbol: Cd3e\nGene ID (NCBI): 315609\nRRID: AB_3670133\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: A6J423\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886190383273,"sku":"31889-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31889-1-ap","provider":"Iright","version":"1.0","type":"link"}