{"product_id":"proteintech-31903-1-ap","title":"Proteintech, 31903-1-AP, ZNF280A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ZNF280A (31903-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF280A in WB, ELISA applications with reactivity to human, mouse, rat samples\n31903-1-AP targets ZNF280A in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells, mouse adrenal gland tissue,  mouse kidney tissue,  rat kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nZinc finger proteins are the largest transcription factor family in the human genome and play a significant role in regulating and managing gene expression, including development, differentiation, metabolism, and autophagy (PMID: 18253864; 27411336). Zinc finger protein 280A (ZNF280A, also known as SUHW1, ZNF280, and ZNF636) is a member of the zinc-finger protein family, carrying two consecutive Cys2His2 zinc finger domains (PMID: 33414445). Cys2-His2 (C2H2) zinc finger domains (ZFs) were originally identified as DNA-binding domains, and uncharacterized domains are typically assumed to function in DNA binding (PMID: 18253864).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35942 Product name: Recombinant human ZNF280A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 461-542 aa of BC053901 Sequence: LTLKEEIEHKTKDHQTFKKPEQLQGLPSETKVIIQTSVQPGSSGMASVIVSNTDPQSSPVKTKKKTAMNTRDSRLPCSKDSS Predict reactive species\nFull Name: zinc finger protein 280A\nCalculated Molecular Weight: 60 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC053901\nGene Symbol: ZNF280A\nGene ID (NCBI): 129025\nRRID: AB_3670138\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P59817\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868844445865,"sku":"31903-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31903-1-ap","provider":"Iright","version":"1.0","type":"link"}