{"product_id":"proteintech-31908-1-ap","title":"Proteintech, 31908-1-AP, FRMD1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FRMD1 (31908-1-AP) by Proteintech is a Polyclonal antibody targeting FRMD1 in WB, ELISA applications with reactivity to human, mouse, rat samples\n31908-1-AP targets FRMD1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse colon tissue, K-562 cells,  mouse testis tissue,  mouse thymus tissue,  rat thymus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe FERM structural domain of FRMD1 (FERM Domain Containing 1) is widely found in cytoskeleton-associated proteins, which are capable of connecting the cytoskeleton to the cell membrane and is involved in signaling. FRMD1 is predicted to be involved in the positive regulation of the Hippo signaling pathway and may play a role in the cytoplasmic side of the cytoskeleton and apical plasma membrane. Although there are fewer studies on the role of FRMD1 in disease, its expression pattern in cancer and lymphoid tissues suggests that it may have important biological functions.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36382 Product name: Recombinant human FRMD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 205-300 aa of BC137144 Sequence: RYFEPHSYFPQWIITKRGIDYILRHMPTLHRERQGLSPKEAMLCFIQEACRLEDVPVHFFRLHKDKKEGRPTVILGLALRGVHIYQGKKLEIQLDG Predict reactive species\nFull Name: FERM domain containing 1\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC137144\nGene Symbol: FRMD1\nGene ID (NCBI): 79981\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8N878\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887643381929,"sku":"31908-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31908-1-ap","provider":"Iright","version":"1.0","type":"link"}