{"product_id":"proteintech-31917-1-ap","title":"Proteintech, 31917-1-AP, TMEM143 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TMEM143 (31917-1-AP) by Proteintech is a Polyclonal antibody targeting TMEM143 in WB, IHC, ELISA applications with reactivity to human samples\n31917-1-AP targets TMEM143 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HH cells, HepG2 cells,  Jurkat cells,  Ramos cells\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTransmembrane protein 143 (TMEM143) is a transmembrane protein and a member of the TMEM (Transmembrane) protein family, which is located in mitochondria (PMID: 11256614). It is known that members of the TMEM family play an important role in the development and metastasis of cancer, especially in conveying information between the extracellular environment and cytoplasmic proteins (PMID: 31454669).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36277 Product name: Recombinant human TMEM143 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 51-200 aa of BC016919 Sequence: MGEYRKMWNPREPRDWAQQYRERFIPFSKEQLLRLLIQEFHSSPAEKAALEAFSAHVDFCTLFHYHQILARLQALYDPINPDRETLDQPSLTDPQRLSNEQEVLRALEPLLAQANFSPLSEDTLAYALVVHHPQDEVQVTVNLDQYVYIH Predict reactive species\nFull Name: transmembrane protein 143\nCalculated Molecular Weight: 52 kDa\nObserved Molecular Weight: 45-52 kDa\nGenBank Accession Number: BC016919\nGene Symbol: TMEM143\nGene ID (NCBI): 55260\nRRID: AB_3670142\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96AN5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887830454441,"sku":"31917-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31917-1-ap","provider":"Iright","version":"1.0","type":"link"}