{"product_id":"proteintech-31918-1-ap","title":"Proteintech, 31918-1-AP, TOR4A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TOR4A (31918-1-AP) by Proteintech is a Polyclonal antibody targeting TOR4A in WB, ELISA applications with reactivity to human samples\n31918-1-AP targets TOR4A in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, HCT 116 cells,  HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTOR4A is known to be a member of the AAA+ ATPase superfamily of proteins that are involved in the degradation of misfolded proteins via the endoplasmic reticulum-associated protein degradation (ERAD) pathway (PMID: 25873482).TOR4A is an oncogene and that DNER acts as a tumor suppressor gene by inhibiting TOR4A and its functions of promoting p-AKT and inhibiting antiapoptotic protein expression (PMID: 36204885).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36307 Product name: Recombinant human C9orf167 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-121 aa of NM_017723 Sequence: MDRGQPSLEPAAAAPRASGRCVIAPVRAVLRLRRRVCVLRKRRLLQPGGGPDVGTGAPRPGCSPRAPRADLDQPKFFTFDSPAELPSRTPRKKRRRSRLVLYPETSRKYRPRVEHRSRAQR Predict reactive species\nFull Name: chromosome 9 open reading frame 167\nCalculated Molecular Weight: 46kDa\nObserved Molecular Weight: 38, 40 kDa\nGenBank Accession Number: NM_017723\nGene Symbol: C9orf167\nGene ID (NCBI): 54863\nRRID: AB_3670143\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9NXH8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887835467945,"sku":"31918-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31918-1-ap","provider":"Iright","version":"1.0","type":"link"}