{"product_id":"proteintech-31919-1-ap","title":"Proteintech, 31919-1-AP, CHD7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CHD7 (31919-1-AP) by Proteintech is a Polyclonal antibody targeting CHD7 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n31919-1-AP targets CHD7 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  HuH-7 cells,  Jurkat cells\nPositive IHC detected in: mouse cerebellum tissue, rat cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:750-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nChromodomain helicase DNA-binding protein 7 (CHD7) is an ATP-dependent eukaryotic chromatin remodeling enzyme that regulates nucleosome positioning and alters DNA accessibility, and is essential for organ development.CHD7 is a gene known to be associated with CHARGE syndrome, Kallmann syndrome, and hypogonadotropic hypogonadism, where it is associated with CHARGE syndrome is a congenital multiorgan disorder characterized by eye defects, heart defects, posterior nasal atresia, growth retardation, genital anomalies, ear malformations, and deafness. The effects of CHD7 mutations on inner ear development, neuronal differentiation, cardiovascular development, and regulation of bone lipid homeostasis have been studied.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36595 Product name: Recombinant human CHD7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 20-200 aa of BC110818 Sequence: GLEGLGECGYPENPVNPMGQQMPIDQGFASLQPSLHHPSTNQNQTKLTHFDHYNQYEQQKMHLMDQPNRMMSNTPGNGLASPHSQYHTPPVPQVPHGGSGGGQMGVYPGMQNERHGQSFVDSSSMWGPRAVQVPDQIRAPYQQQQPQPQPPQPAPSGPPAQGHPQHMQQMGSYMARGDFSM Predict reactive species\nFull Name: chromodomain helicase DNA binding protein 7\nObserved Molecular Weight: 350 kDa\nGenBank Accession Number: BC110818\nGene Symbol: CHD7\nGene ID (NCBI): 55636\nRRID: AB_3670144\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9P2D1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886510788777,"sku":"31919-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31919-1-ap","provider":"Iright","version":"1.0","type":"link"}