{"product_id":"proteintech-31924-1-ap","title":"Proteintech, 31924-1-AP, ATL1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ATL1 (31924-1-AP) by Proteintech is a Polyclonal antibody targeting ATL1 in WB, ELISA applications with reactivity to human, rat, pig samples\n31924-1-AP targets ATL1 in WB, ELISA applications and shows reactivity with human, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat brain tissue, fetal human brain tissue,  pig brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATL1 encodes atlastin-1, a GTPase that plays a crucial role in maintaining the structure and function of the endoplasmic reticulum. Mutations in ATL1 are one of the most common causes of hereditary spastic paraplegia (HSP) (PMID: 38851544). tlastin-1 is regulated by ubiquitination, a post-translational modification that can affect its activity and localization. For example, the E3 ubiquitin ligase SYVN1 has been shown to ubiquitinate atlastin-1, inhibiting its GTPase activity and thereby affecting ER morphology (PMID: 32916628).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag29223 Product name: Recombinant human ATL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 449-558 aa of BC010708 Sequence: ATLFVVIFITYVIAGVTGFIGLDIIASLCNMIMGLTLITLCTWAYIRYSGEYRELGAVIDQVAAALWDQGSTNEALYKLYSAAATHRHLYHQAFPTPKSESTEQSEKKKM Predict reactive species\nFull Name: atlastin GTPase 1\nCalculated Molecular Weight: 64 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC010708\nGene Symbol: ATL1\nGene ID (NCBI): 51062\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8WXF7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885095014569,"sku":"31924-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31924-1-ap","provider":"Iright","version":"1.0","type":"link"}