{"product_id":"proteintech-31967-1-ap","title":"Proteintech, 31967-1-AP, SHB Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SHB (31967-1-AP) by Proteintech is a Polyclonal antibody targeting SHB in WB, ELISA applications with reactivity to human, mouse, rat samples\n31967-1-AP targets SHB in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, L02 cells,  C2C12 cells,  H9C2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSH2 domain-containing adapter protein B (SHB) is an adaptor protein that operates downstream of tyrosine kinases. It is crucial in various cellular responses, including cell survival, differentiation, and proliferation (PMID: 29792386). SHB is involved in the modulation of focal adhesion kinase (FAK) signaling, which is important for regulating cell cycle progression in hematopoietic stem cells (PMID: 23528453). The protein has also been implicated in the progression of myeloproliferative disorders by affecting the activity of FAK and other signaling intermediates (PMID: 24952416).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35936 Product name: Recombinant human SHB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 214-375 aa of BC136581 Sequence: ACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYMEPYEAQRIMTEFQRQESVRSQHKGIQLYDTPYEPEGQSVDSDSESTVSPRLRESKLPQDDDRPADEYDQPWEWNRVTIPALAAQFNGNEKRQSSPSPSRDRRRQLR Predict reactive species\nFull Name: Src homology 2 domain containing adaptor protein B\nCalculated Molecular Weight: 55 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC136581\nGene Symbol: SHB\nGene ID (NCBI): 6461\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q15464\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868844085417,"sku":"31967-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-31967-1-ap","provider":"Iright","version":"1.0","type":"link"}