{"product_id":"proteintech-32025-1-ap","title":"Proteintech, 32025-1-AP, RAVER2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAVER2 (32025-1-AP) by Proteintech is a Polyclonal antibody targeting RAVER2 in IP, ELISA applications with reactivity to human samples\n32025-1-AP targets RAVER2 in IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IP detected in: HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRaver2 was identified as a novel member of the hnRNP family based on sequence homology within three RNA recognition motifs and its general domain organization reminiscent of the previously described raver1 protein.  Like raver1, raver2 contains two putative nuclear localization signals and a potential nuclear export sequence, and also displays nucleo-cytoplasmic shuttling in a heterokaryon assay.  In glia cells and neurons, raver2 localizes to the nucleus.  Moreover, the protein interacts with polypyrimidine tract binding protein (PTB) suggesting that it may participate in PTB-mediated nuclear functions.  In contrast to ubiquitously expressed raver1, raver2 exerts a distinct spatio-temporal expression pattern during embryogenesis and is essentially restricted to brain, lung, and kidney in the adult mouse (PMID: 16051233).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36879 Product name: Recombinant human RAVER2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 455-691 aa of BC065303 Sequence: GIGSVLPLKKELGHHHGEAHKTSSLIPTQTTITAGMGMLPFFPNQHIAGQAGPGHSNTQEKQPATVGMAEGNFSGSQPYLQSFPNLAAGSLLVGHHKQQQSQPKGTEISSGAASKNQTSLLGEPPKEIRLSKNPYLNLASVLPSVCLSSPASKTTLHKTGIASSILDAISQGSESQHALEKCIAYSPPFGDYAQVSSLRNEKRGSSYLISAPEGGSVECVDQHSQGTGAYYMETYLKKKRVY Predict reactive species\nFull Name: ribonucleoprotein, PTB-binding 2\nCalculated Molecular Weight: 74\/72 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: BC065303\nGene Symbol: RAVER2\nGene ID (NCBI): 55225\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9HCJ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887779827881,"sku":"32025-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32025-1-ap","provider":"Iright","version":"1.0","type":"link"}