{"product_id":"proteintech-32066-1-ap","title":"Proteintech, 32066-1-AP, CACTIN Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CACTIN (32066-1-AP) by Proteintech is a Polyclonal antibody targeting CACTIN in WB, ELISA applications with reactivity to human samples\n32066-1-AP targets CACTIN in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  Jurkat cells,  MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCACTIN plays a role in pre-mRNA splicing by facilitating excision of a subset of introns (PubMed:28062851).CACTIN was reported to be involved in the regulation of innate immune response (PubMed:20829348). CACTIN acts as a negative regulator of Toll-like receptor, interferon-regulatory factor (IRF) and canonical NF-kappa-B signaling pathways (PubMed:20829348, PubMed:26363554). CACTIN contributes to the regulation of transcriptional activation of NF-kappa-B target genes in response to endogenous pro-inflammatory stimuli (PubMed:20829348, PubMed:26363554). CACTIN has two isforms (89kDa and 108 kDa).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35645 Product name: Recombinant human CACTIN protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-188 aa of NM_021231 Sequence: MGRDTRSRSRSAGRRGRRRQSQSGSRSRSRSHGRRNRRRREDEGRRRRRRRSRERRSDSEEERWQRSGMRSRSPPRPKWHSRDGSSQSDSGEEQSRGQWARRRRRARSWSPSSSASSSASPGRSQSPRAAAAALSQQQSLQERLRLREERKQQEELMKAFETPEEKRARRLAKKEAKERKKREKMGWG Predict reactive species\nFull Name: chromosome 19 open reading frame 29\nCalculated Molecular Weight: 108 kDa, 89 kDa\nObserved Molecular Weight: 120 kDa\nGenBank Accession Number: NM_021231\nGene Symbol: C19orf29\nGene ID (NCBI): 58509\nRRID: AB_3670183\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8WUQ7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885739593897,"sku":"32066-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32066-1-ap","provider":"Iright","version":"1.0","type":"link"}