{"product_id":"proteintech-32111-1-ap","title":"Proteintech, 32111-1-AP, LRRC45 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LRRC45 (32111-1-AP) by Proteintech is a Polyclonal antibody targeting LRRC45 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n32111-1-AP targets LRRC45 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, HeLa cells,  HEK-293 cells,  U2OS cells\nPositive IF\/ICC detected in: A431 cells, U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe Leucine-Rich Repeat-Containing 45 (LRRC45) gene, a relatively unexplored entity in the realm of genomic studies, has recently garnered attention for its potential role in cellular processes and disease pathogenesis. Characterized by its leucine-rich repeats, a motif known for facilitating protein-protein interactions, LRRC45 is implicated in various cellular functions, including signal transduction and intracellular trafficking. LRRC45 promotes lung cancer proliferation and progression by enhancing c-MYC, Slug, MMP2, and MMP9 expression (PMID: 39326735).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36776 Product name: Recombinant human LRRC45 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 380-512 aa of BC014109 Sequence: ERKFRCQQEQLFQTRQEMTSMSAELKMRAIQAEERLDMEKRRCRQSLEDSESLRIKEVEHMTRHLEESEKAMQERVQRLEAARLSLEEELSRVKAAALSERGQAEEELIKAKSQARLEEQQRLAHLEDKLRLL Predict reactive species\nFull Name: leucine rich repeat containing 45\nCalculated Molecular Weight: 76 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC014109\nGene Symbol: LRRC45\nGene ID (NCBI): 201255\nRRID: AB_3670195\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96CN5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887708065961,"sku":"32111-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32111-1-ap","provider":"Iright","version":"1.0","type":"link"}