{"product_id":"proteintech-32120-1-ap","title":"Proteintech, 32120-1-AP, MBOAT4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MBOAT4 (32120-1-AP) by Proteintech is a Polyclonal antibody targeting MBOAT4 in WB, ELISA applications with reactivity to human samples\n32120-1-AP targets MBOAT4 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMBOAT4, also known as ghrelin O-acyltransferase (GOAT), is an endoplasmic reticulum enzyme that catalyzes the octanoylation of the peptide hormone ghrelin, which is essential for the binding of ghrelin to its receptor and the subsequent regulation of food intake, growth hormone secretion, and inhibition of insulin secretion (PMID: 34946685). MBOAT4 is considered a potential therapeutic target for treating disorders related to ghrelin signaling (PMID: 32564644).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37237 Product name: Recombinant human MBOAT4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 262-324 aa of NM_001100916 Sequence: DDSLLHAAGFGPELGQSPGEEGYVPDADIWTLERTHRISVFSRKWNQSTARWLRRLVFQHSRA Predict reactive species\nFull Name: membrane bound O-acyltransferase domain containing 4\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: NM_001100916\nGene Symbol: MBOAT4\nGene ID (NCBI): 619373\nRRID: AB_3670198\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q96T53\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868843331753,"sku":"32120-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32120-1-ap","provider":"Iright","version":"1.0","type":"link"}