{"product_id":"proteintech-32169-1-ap","title":"Proteintech, 32169-1-AP, PLEKHA2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLEKHA2 (32169-1-AP) by Proteintech is a Polyclonal antibody targeting PLEKHA2 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n32169-1-AP targets PLEKHA2 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, JurKat cells,  RT-4 cells\nPositive IF\/ICC detected in: HeLa cells, A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLEKHA2 (Pleckstrin homology domain containing A2), also known as TAPP2, is a member of the PLEKHA family of proteins.PLEKHA2 is a junctional protein with a Pleckstrin homology domain that is involved in signaling after lymphocyte activation and plays an important role in cytoskeletal reorganization driven by phosphatidylinositol 3-kinase.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36596 Product name: Recombinant human PLEKHA2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 101-205 aa of BC166639 Sequence: MKDWVEALNQASKITVPKGGGLPMTTEVLKSLAAPPALEKKPQVAYKTEIIGGVVVHTPISQNGGDGQEGSEPGSHTILRRSQSYIPTSGCRASTGPPLIKSGYC Predict reactive species\nFull Name: pleckstrin homology domain containing, family A (phosphoinositide binding specific) member 2\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC166639\nGene Symbol: PLEKHA2\nGene ID (NCBI): 59339\nRRID: AB_3670213\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9HB19\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887765409961,"sku":"32169-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32169-1-ap","provider":"Iright","version":"1.0","type":"link"}