{"product_id":"proteintech-32175-1-ap","title":"Proteintech, 32175-1-AP, C1QL3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C1QL3 (32175-1-AP) by Proteintech is a Polyclonal antibody targeting C1QL3 in WB, ELISA applications with reactivity to human samples\n32175-1-AP targets C1QL3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC1Q-like (C1QL) proteins bind to the adhesion G protein coupled receptor B3 (ADGRB3) and act at synapses in a subset of circuits. Complement C1q-like 3 (C1QL3, also known as CTRP13) is one of the C1QL proteins. Some C1QL3 migrated as a monomer (~26 kDa) and some as a trimer (60-70 kDa), indicating a desired substantial yet incomplete crosslinking of monomers (PMID: 33337553). The doublet band of trimer probably represents differential posttranslational modifications (PMID: 21378161). Bands of larger molecular weights suggested either trimers cross-linked into higher molecular weight oligomers or C1QL3 cross-linked to binding partners (PMID: 33337553).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37280 Product name: Recombinant human C1QL3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 91-140 aa of BC127716 Sequence: GEKGEPGRQGLPGPPGAPGLNAAGAISAATYSTVPKIAFYAGLKRQHEGY Predict reactive species\nFull Name: complement component 1, q subcomponent-like 3\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 70 kDa, 27 kDa\nGenBank Accession Number: BC127716\nGene Symbol: C1QL3\nGene ID (NCBI): 389941\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q5VWW1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885550981289,"sku":"32175-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32175-1-ap","provider":"Iright","version":"1.0","type":"link"}