{"product_id":"proteintech-32178-1-ap","title":"Proteintech, 32178-1-AP, HMCN2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HMCN2 (32178-1-AP) by Proteintech is a Polyclonal antibody targeting HMCN2 in WB, IP, ELISA applications with reactivity to human samples\n32178-1-AP targets HMCN2 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells\nPositive IP detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:200-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHMCN2 (Hemicentin-2) is a large extracellular matrix protein belonging to the fibronectin family. HMCN2 proteins form a complex network of microfibrils in the extracellular matrix that is essential for the maintenance of tissue structure and function. HMCN2 is expressed in epithelial cells and muscle tissues, and may play an important role in muscle-tendon attachment. HMCN2 expression and localization suggests that it has an important role in maintaining the integrity of skin and muscle tissue. It may maintain tissue structure and function by interacting with other extracellular matrix proteins, such as fibronectin and elastic fibers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37696 Product name: Recombinant human HMCN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 330-536 aa of XM_011518465.3 Sequence: TLEWPLQGVPISLVINSTGLKAPGRLDSVELAQSSGKPLLTLPTKPLSNGSTHQLWGGPPFHTPKERFYLKVKGKDHEGNPLLRVSGVSYSGVAPGAPLVSMAPRIHGYLHQPLLVSCSVHSALPFRLQLRRGEARLGEERHFQESGNSSWEILRASKAEEGTYECTAVSRAGTGRAKAQIVVTDPPPQLVPAPNVTVSPGETAVLS Predict reactive species\nFull Name: hemicentin 2\nCalculated Molecular Weight: 542kDa，5059aa\nObserved Molecular Weight: 550 kDa\nGenBank Accession Number: XM_011518465.3\nGene Symbol: HMCN2\nGene ID (NCBI): 256158\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8NDA2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887669268649,"sku":"32178-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32178-1-ap","provider":"Iright","version":"1.0","type":"link"}