{"product_id":"proteintech-32196-1-ap","title":"Proteintech, 32196-1-AP, CEACAM16 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CEACAM16 (32196-1-AP) by Proteintech is a Polyclonal antibody targeting CEACAM16 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n32196-1-AP targets CEACAM16 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: human placenta tissue, human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCEACAM16 (Carcinoembryonic Antigen-Related Cell Adhesion Molecule 16) is a member of the CEA family of cell adhesion molecules. It is a critical component of the tectorial membrane in the inner ear, playing a significant role in maintaining hearing function. Mutations in the CEACAM16 gene are associated with autosomal dominant nonsyndromic hearing loss (DFNA4B), characterized by progressive high-frequency hearing impairment. Research has shown that loss or dysfunction of CEACAM16 leads to structural abnormalities in the tectorial membrane, thereby affecting hearing. The identification of CEACAM16 has provided important insights into the genetic basis of hereditary hearing loss and has implications for the diagnosis and treatment of hearing disorders.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37542 Product name: Recombinant human CEACAM16 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 295-425 aa of BC156855 Sequence: AKNTKTLLSGSASVVVKLSAAAVATMIVPVPTKPTEGQDVTLTVQGYPKDLLVYAWYRGPASEPNRLLSQLPSGTWIAGPAHTGREVGFPNCSLLVQKLNLTDTGRYTLKTVTVQGKTETLEVELQVAPLG Predict reactive species\nFull Name: carcinoembryonic antigen-related cell adhesion molecule 16\nObserved Molecular Weight: 48 kDa\nGenBank Accession Number: BC156855\nGene Symbol: CEACAM16\nGene ID (NCBI): 388551\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q2WEN9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886442107049,"sku":"32196-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32196-1-ap","provider":"Iright","version":"1.0","type":"link"}