{"product_id":"proteintech-32198-1-ap","title":"Proteintech, 32198-1-AP, C21orf33 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C21orf33 (32198-1-AP) by Proteintech is a Polyclonal antibody targeting C21orf33 in WB, ELISA applications with reactivity to human, mouse, rat samples\n32198-1-AP targets C21orf33 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Hela cells,  HepG2 cells,  K-562 cells,  THP-1 cells,  mouse liver tissue,  rat liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGATD3A is a member of glutamine amidotransferase-like class 1 domain-containing (GATD) family. GATD proteins classically generate ammonia by amidolysis from the glutamine amide nitrogen, transferring it to an acceptor substrate in a variety of anabolic reactions involving purine and pyrimidine synthesis (PMID: 9575335). GATD3A restricts the formation of AGEs in mitochondria and is a relevant target for diseases where AGE deposition is a pathological hallmark (PMID: 35307029).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37527 Product name: Recombinant human C21orf33 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 42-268 aa of BC002370 Sequence: AARVALVLSGCGVYDGTEIHEASAILVHLSRGGAEVQIFAPDVPQMHVIDHTKGQPSEGESRNVLTESARIARGKITDLANLSAANHDAAIFPGGFGAAKNLSTFAVDGKDCKVNKEVERVLKEFHQAGKPIGLCCIAPVLAAKVLRGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETALHYIHDGIGAMVRKVLELTGK Predict reactive species\nFull Name: chromosome 21 open reading frame 33\nCalculated Molecular Weight: 268 aa, 28 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC002370\nGene Symbol: C21orf33\nGene ID (NCBI): 8209\nRRID: AB_3670221\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P0DPI2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885569364137,"sku":"32198-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32198-1-ap","provider":"Iright","version":"1.0","type":"link"}