{"product_id":"proteintech-32243-1-ap","title":"Proteintech, 32243-1-AP, GPR183\/EBI2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GPR183\/EBI2 (32243-1-AP) by Proteintech is a Polyclonal antibody targeting GPR183\/EBI2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n32243-1-AP targets GPR183\/EBI2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nG-protein-coupled receptor 183, also known as Epstein-Barr virus-induced gene 2 (EBI2), was initially identified in B cells and is the most upregulated gene after infection with Epstein-Barr virus (PMID:37353188). GPR183 is known to play a key role in the development of antibody responses in secondary lymphoid organs (PMID:23473835).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36765 Product name: Recombinant human GPR183 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 313-361 aa of BC020752 Sequence: KGYKRKVMRMLKRQVSVSISSAVKSAPEENSREMTETQMMIHSKSSNGK Predict reactive species\nFull Name: G protein-coupled receptor 183\nCalculated Molecular Weight: 361 aa, 41 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC020752\nGene Symbol: EBI2\nGene ID (NCBI): 1880\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P32249\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887657341097,"sku":"32243-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32243-1-ap","provider":"Iright","version":"1.0","type":"link"}