{"product_id":"proteintech-32272-1-ap","title":"Proteintech, 32272-1-AP, Proenkephalin-A Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Proenkephalin-A (32272-1-AP) by Proteintech is a Polyclonal antibody targeting Proenkephalin-A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n32272-1-AP targets Proenkephalin-A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue, mouse brain tissue,  human heart tissue,  rat brain tissue\nPositive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SH-SY5Y cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProenkephalin-A (PENK) is also named as Synenkephalin, Met-enkephalin and Opioid growth factor (OGF), and belongs to the opioid neuropeptide precursor family. PENK is a neuropeptide that competes with and mimics the effects of opiate drugs. They play a role in a number of physiologic functions, including pain perception and responses to stress (PMID:7057924). PENK hypermethylation is also associated with bladder cancer, hepatocellular carcinoma, colorectal cancer, and prostate cancer (PMID:36403035). Proenkephalin (PENK) represents a new candidate to determine kidney function. This peptide is cleaved from the precursor  peptide preproenkephalin A alongside enkephalins (endogenous opioids) and is filtrated in the glomerulus (PMID: 33636859).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag27972 Product name: Recombinant human PENK protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-267 aa of BC032505 Sequence: YGGFMKRYGGFMKKMDELYPMEPEEEANGSEILAKRYGGFMKKDAEEDDSLANSSDLLKELLETGDNRERSHHQDGSDNEEEVSKRYGGFMRGLKRSPQLEDEAKELQKRYGGFMRRVGRPEWWMDYQKRYGGFLKRFAEALPSDEEGESYSKEVPEMEKRYGGFMRF Predict reactive species\nFull Name: proenkephalin\nCalculated Molecular Weight: 267 aa, 31 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC032505\nGene Symbol: Proenkephalin A\nGene ID (NCBI): 5179\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P01210\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887774027945,"sku":"32272-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32272-1-ap","provider":"Iright","version":"1.0","type":"link"}