{"product_id":"proteintech-32297-1-ap","title":"Proteintech, 32297-1-AP, NXPE4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NXPE4 (32297-1-AP) by Proteintech is a Polyclonal antibody targeting NXPE4 in WB, ELISA applications with reactivity to human, mouse, rat samples\n32297-1-AP targets NXPE4 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNXPE4, also known as FAM55D and C11orf33, belongs to thNeurexophilin family. NXPE4 was down-regulated when TNFAIP3, a key regulator in inflammatory bowel disease (IBD), was knocked down, and IBD are closely associated with the incidence of CRC. Thus, NXPE4 may be a key factor in the pathogenesis of IBD and CRC (PMID: 31297877).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35198 Product name: Recombinant human NXPE4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 285-435 aa of NM_001077639.1 Sequence: MEKFNTISVSKCNKETVAMKEKCKFGMTSTIPSGHVWRNTWNPVSCSLATVKMKECLRGKLIYLMGDSTIRQWMEYFKASINTLKSVDLHESGKLQHQLAVDLDRNINIQWQKYCYPLIGSMTYSVKEMEYLTRAIDRTGGEKNTVIVISL Predict reactive species\nFull Name: family with sequence similarity 55, member D\nCalculated Molecular Weight: 62 kDa\nObserved Molecular Weight: 65 kDa\nGenBank Accession Number: NM_001077639.1\nGene Symbol: FAM55D\nGene ID (NCBI): 54827\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q6UWF7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887744602281,"sku":"32297-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32297-1-ap","provider":"Iright","version":"1.0","type":"link"}