{"product_id":"proteintech-32337-1-ap","title":"Proteintech, 32337-1-AP, SIGNR1\/CD209b Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SIGNR1\/CD209b (32337-1-AP) by Proteintech is a Polyclonal antibody targeting SIGNR1\/CD209b in WB, IHC, ELISA applications with reactivity to mouse, rat samples\n32337-1-AP targets SIGNR1\/CD209b in WB, IHC, ELISA applications and shows reactivity with mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse skin tissue, rat skin tissue,  rat spleen tissue\nPositive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSIGNR1 (CD209b) is a mouse homolog of the human DC-SIGN receptor (PMID: 11581173). SIGNR1 is a type II transmembrane protein with an extracellular domain consisting of a neck region made up of four repeats of 28 amino acids and a carbohydrate recognition domain (PMID: 15583012). It is expressed on marginal zone macrophages and peritoneal macrophages and is a key receptor for the recognition and efficient clearance of pathogens by the innate immune system.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg1497 Product name: Recombinant Mouse SIGNR1\/CD209b protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 74-325 aa of NM_026972.5 Sequence: QVSKTPNTERQKEQEKILQELTQLTDELTSRIPISQGKNESMQAKITEQLMQLKTELLSRIPIFQGQNESIQEKISEQLMQLKAELLSKISSFPVKDDSKQEKIYQQLVQMKTELFRLCRLCPWDWTFLLGNCYFFSKSQRNWNDAVTACKEVKAQLVIINSDEEQTFLQQTSKAKGPTWMGLSDLKKEATWLWVDGSTLSSRFQKYWNRGEPNNIGEEDCVEFAGDGWNDSKCELKKFWICKKSATPCTEG Predict reactive species\nFull Name: CD209b antigen\nCalculated Molecular Weight: 37 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: NM_026972.5\nGene Symbol: Cd209b\nGene ID (NCBI): 69165\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8CJ91-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887801979049,"sku":"32337-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32337-1-ap","provider":"Iright","version":"1.0","type":"link"}