{"product_id":"proteintech-32376-1-ap","title":"Proteintech, 32376-1-AP, ELA3B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ELA3B (32376-1-AP) by Proteintech is a Polyclonal antibody targeting ELA3B in WB, ELISA applications with reactivity to human, mouse, rat samples\n32376-1-AP targets ELA3B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse pancreas tissue, rat pancreas tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:16000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nELA3B, or elastase 3B, is a protein encoded by the human ELA3B gene. It belongs to the elastase family of serine proteases, which are enzymes that cleave peptide bonds in proteins. ELA3B is mainly expressed in the pancreas and is involved in the digestion of dietary proteins. Like other elastases, it plays a role in the degradation of elastin, a key component of connective tissue, as well as other extracellular matrix proteins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36965 Product name: Recombinant human ELA3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 79-192 aa of BC005216 Sequence: WTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVACGNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALLPVVDYEHCSRWN Predict reactive species\nFull Name: elastase 3B, pancreatic\nCalculated Molecular Weight: 29 kDa\nObserved Molecular Weight: 29-32 kDa\nGenBank Accession Number: BC005216\nGene Symbol: ELA3B\nGene ID (NCBI): 23436\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P08861\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887494418601,"sku":"32376-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32376-1-ap","provider":"Iright","version":"1.0","type":"link"}