{"product_id":"proteintech-32382-1-ap","title":"Proteintech, 32382-1-AP, ARHGAP44 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARHGAP44 (32382-1-AP) by Proteintech is a Polyclonal antibody targeting ARHGAP44 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, rat samples\n32382-1-AP targets ARHGAP44 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, rat brain tissue,  LNCaP cells\nPositive IHC detected in: human urothelial carcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:750-1:3000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRho GTPase-activating protein 44 (ARHGAP44) belongs to the Rho GTPase-activating protein (RhoGAP) family, also known as Rich2.ARHGAP44 plays an important role in cytoskeletal dynamics, cellular motility and signaling. Its high expression in osteosarcoma correlates with tumor malignancy, suggesting its potential as a potential therapeutic target. In addition, ARHGAP44 may also be involved in the pathogenesis of diabetes and cardiovascular diseases, and its specific role in these diseases needs to be further investigated in the future.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38196 Product name: Recombinant human ARHGAP44 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 580-772 aa of NM_001321166 Sequence: LQPGPERTSTTKSKELSPGSAQKGSPGSSQGTACAGTQPGAQPGAQPGASPSPSQPPADQSPHTLRKVSKKLAPIPPKVPFGQPGAMADQSAGQPSPVSLSPTPPSTPSPYGLSYPQGYSLASGQLSPAAAPPLASPSVFTSTLSKSRPTPKPRQRPTLPPPQPPTVNLSASSPQSTEAPMLDGMSPGESMST Predict reactive species\nFull Name: Rho-type GTPase-activating protein RICH2\nCalculated Molecular Weight: 818aa, 89 kDa\nObserved Molecular Weight: 80-100 kDa\nGenBank Accession Number: NM_001321166\nGene Symbol: RICH2\nGene ID (NCBI): 9912\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q17R89\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46885029019817,"sku":"32382-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32382-1-ap","provider":"Iright","version":"1.0","type":"link"}