{"product_id":"proteintech-32425-1-ap","title":"Proteintech, 32425-1-AP, EDDM3B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EDDM3B (32425-1-AP) by Proteintech is a Polyclonal antibody targeting EDDM3B in WB, IP, ELISA applications with reactivity to human, mouse, rat samples\n32425-1-AP targets EDDM3B in WB, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse testis tissue, rat testis tissue\nPositive IP detected in: human testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEDDM3B (Epididymal secretory protein E3-beta), also known as FAM12B, HE3B (Human epididymis-specific protein 3-beta), is highly enriched in the epididymis and is involved in the secretion of glycoproteins that interact with sperm membranes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37630 Product name: Recombinant human EDDM3B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 55-118 aa of NM_022360 Sequence: RENEALKDKSSHMFIYISWYKIEHICTSDNWMDRFRNAYVWVQNPLKVLKCHQENSKNSYTESR Predict reactive species\nFull Name: family with sequence similarity 12, member B (epididymal)\nCalculated Molecular Weight: 17 kDa\nObserved Molecular Weight: 18 kDa\nGenBank Accession Number: NM_022360\nGene Symbol: FAM12B\nGene ID (NCBI): 64184\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: P56851\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887419936937,"sku":"32425-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32425-1-ap","provider":"Iright","version":"1.0","type":"link"}