{"product_id":"proteintech-32442-1-ap","title":"Proteintech, 32442-1-AP, Ficolin 2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Ficolin 2 (32442-1-AP) by Proteintech is a Polyclonal antibody targeting Ficolin 2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n32442-1-AP targets Ficolin 2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat lung tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse liver tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFicolins are a group of oligomeric lectins with subunits consisting of both collagen-like and fibrinogen-like domains (PMID: 20375620). They are innate pattern recognition receptors and play integral roles in the immune response. In humans, there are three ficolins termed M-, L-, and H-ficolin (also referred to as ficolin-1, -2, and -3) whereas rodents only possess ficolin-A and -B, which are the orthologues of human L- and M-ficolin, respectively (PMID: 30868077). Ficolin 2 recognizes pathogen-associated pattern molecules (PAMPs) on the surface of pathogenic microorganisms, activates the complement lectin pathway, and binds to mannose-binding lectin-associated serine proteases (MASPs) to exert immune defense function (PMID: 21315829).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag37525 Product name: Recombinant human FCN2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 228-288 aa of NM_004108 Sequence: EGSAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFA Predict reactive species\nFull Name: ficolin (collagen\/fibrinogen domain containing lectin) 2 (hucolin)\nCalculated Molecular Weight: 34 kDa\nObserved Molecular Weight: 34-35 kDa\nGenBank Accession Number: NM_004108\nGene Symbol: FCN2\nGene ID (NCBI): 2220\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q15485\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887640662185,"sku":"32442-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32442-1-ap","provider":"Iright","version":"1.0","type":"link"}