{"product_id":"proteintech-32476-1-ap","title":"Proteintech, 32476-1-AP, IPO8 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe IPO8 (32476-1-AP) by Proteintech is a Polyclonal antibody targeting IPO8 in WB, ELISA applications with reactivity to human, mouse samples\n32476-1-AP targets IPO8 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, K-562 cells,  MDA-MB-231 cells,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIPO8(Importin 8) is a gene encoding protein, which is located on human chromosome 12. It belongs to the nuclear protein transport family, and is mainly involved in the process of nuclear protein introduction. IPO8 regulates the transport function of nuclear pore complex by interacting with Ran GTPase and other proteins (PMID: 11682607). It is expected to be located in the cytoplasm and nucleus. IPO8 is associated with many diseases, including VISS syndrome and Loeys-Dietz syndrome. These diseases usually involve cardiovascular defects, skeletal abnormalities and immune loss. The molecular weight of PO8 protein is about 125kDa, and its structure includes helix and β-sheet. It has a specific three-dimensional structure and can form complexes with other protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag35395 Product name: Recombinant human IPO8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 870-1037 aa of BC167853 Sequence: LGLKQVCATRQLVNREDRSKAEKADMEENEEISSDEEETNVTAQAMQSNNGRGEDEEEEDDDWDEEVLEETALEGFSTPLDLDNSVDEYQFFTQALITVQSRDAAWYQLLMAPLSEDQRTALQEVYTLAEHRRTVAEAKKKIEQQGGFTFENKGVLSAFNFGTVPSNN Predict reactive species\nFull Name: importin 8\nObserved Molecular Weight: 120-125 kDa\nGenBank Accession Number: BC167853\nGene Symbol: IPO8\nGene ID (NCBI): 10526\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O15397\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887686045865,"sku":"32476-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32476-1-ap","provider":"Iright","version":"1.0","type":"link"}