{"product_id":"proteintech-32483-1-ap","title":"Proteintech, 32483-1-AP, LELP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LELP1 (32483-1-AP) by Proteintech is a Polyclonal antibody targeting LELP1 in WB, ELISA applications with reactivity to human, rat samples\n32483-1-AP targets LELP1 in WB, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human testis tissue, rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLate cornified envelope-like proline-rich protein 1 (LELP1) is part of the epidermal differentiation complex (EDC), a cluster of genes that encode proteins essential for the differentiation of keratinocytes and the formation of the stratum corneum (PMID: 34112911). A single nucleotide polymorphism (SNP) in the LELP1 gene has been associated with atopic dermatitis, a chronic inflammatory skin disorder characterized by elevated levels of serum immunoglobulin E (IgE) and severe skin inflammation (PMID: 26608070).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36831 Product name: Recombinant human LELP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-98 aa of BC130507 Sequence: MSSDDKSKSNDPKTEPKNCDPKCEQKCESKCQPSCLKKLLQRCFEKCPWEKCPAPPKCLPCPSQSPSSCPPQPCTKPCPPKCPSSCPHACPPPCPPPE Predict reactive species\nFull Name: late cornified envelope-like proline-rich 1\nCalculated Molecular Weight: 11 kDa\nObserved Molecular Weight: 17 kDa\nGenBank Accession Number: BC130507\nGene Symbol: LELP1\nGene ID (NCBI): 149018\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q5T871\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887702757545,"sku":"32483-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32483-1-ap","provider":"Iright","version":"1.0","type":"link"}