{"product_id":"proteintech-32485-1-ap","title":"Proteintech, 32485-1-AP, EDARADD Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EDARADD (32485-1-AP) by Proteintech is a Polyclonal antibody targeting EDARADD in WB, ELISA applications with reactivity to human samples\n32485-1-AP targets EDARADD in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEDARADD (EDAR-associated death domain) is an adaptor protein that mediates the interaction between the extracellular Ectodysplasin A receptor (EDAR) and intracellular signaling components, orchestrating a series of downstream events that regulate key biological processes such as cell proliferation, differentiation, and apoptosis. EDARADD is a 25 KDa death domain-containing adaptor protein. EDARADD was shown to interact with TRAF1, -2 and -3 as well as with TAB2 (TAK1-binding protein 2)  and is therefore likely to be responsible for coupling receptor activation with engagement of the NF-κB pathway (PMID: 23845861).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38064 Product name: Recombinant human EDARADD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC128082 Sequence: MGLRTTKQMGRGTKAPGHQEDHMVKEPVEDTDPSTLSFNMSDKYPIQDTELPKAEECDTITLNCPRNSDMKNQGEENGFPDSTGDPLPEISKDNSCKENCTCSSCLLRAPTISDLLNDQDLLDVIRIKLDPCHPTVKNWRNFASKWGMSYDELCFLEQRPQSPTLEFLLRNSQRTVGQLMELCRLYHRADVEKVLRRWVDEEWPKRERGDPSRHF Predict reactive species\nFull Name: EDAR-associated death domain\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC128082\nGene Symbol: EDARADD\nGene ID (NCBI): 128178\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8WWZ3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887419871401,"sku":"32485-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32485-1-ap","provider":"Iright","version":"1.0","type":"link"}