{"product_id":"proteintech-32511-1-ap","title":"Proteintech, 32511-1-AP, SVIP Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SVIP (32511-1-AP) by Proteintech is a Polyclonal antibody targeting SVIP in WB, ELISA applications with reactivity to human, mouse, rat samples\n32511-1-AP targets SVIP in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PANC-1 cells, mouse brain tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSVIP (Small VCP-interacting protein) is a 9-Kda adaptor endoplasmic reticulum protein that could bind directly to p97\/VCP. SVIP is located on the ER membrane's cytosolic surface. It inhibits the ERAD pathway, which is known independently of ubiquitin, by interacting with p97\/VCP, which has a central role in this pathway. Especially for the ERAD pathway, the SVIP protein has been identified as a negative regulator. SVIP was identified as a novel adapter protein for p97\/VCP by observing its overexpression in cells, which causes extensive vacuolation and deformation of the ER and microtubules (PMID: 39473740).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag36618 Product name: Recombinant human SVIP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-77 aa of NM_001320340 Sequence: MGLCFPCPGESAPPTPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEGGLRWTVS Predict reactive species\nFull Name: small VCP\/p97-interacting protein\nCalculated Molecular Weight: 8kDa\nObserved Molecular Weight: 12 kDa\nGenBank Accession Number: NM_001320340\nGene Symbol: SVIP\nGene ID (NCBI): 258010\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q8NHG7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887820165289,"sku":"32511-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32511-1-ap","provider":"Iright","version":"1.0","type":"link"}