{"product_id":"proteintech-32585-1-ap","title":"Proteintech, 32585-1-AP, CIB2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CIB2 (32585-1-AP) by Proteintech is a Polyclonal antibody targeting CIB2 in WB, ELISA applications with reactivity to human, mouse samples\n32585-1-AP targets CIB2 in WB, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe CIB (calcium and integrin binding) protein family has 4 members (CIB1-CIB4), each composed of 4 EF-hand Ca2+-binding motifs (PMID: 27771768). CIB2 is broadly expressed in a variety of tissues, which plays a role in sensory neurons of the ear and eye involved in the regulation of Ca2+ homeostasis (PMID: 28663585; 29084757; 29255404). Mutations of CIB2 have been associated with autosomal recessive nonsyndromic deafness 48 (DFNB48), as well as syndromic deafness in Usher syndrome, type 1J (USH1J) (PMID: 23331261). The observed molecular weight of CIB2 is 39 kDa because it can form a dimer (PMID: 30174586).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38508 Product name: Recombinant human CIB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-187 aa of NM_006383.3 Sequence: MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHSRFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVAAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEEEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI* Predict reactive species\nFull Name: calcium and integrin binding family member 2\nCalculated Molecular Weight: 22 kDa，187aa\nObserved Molecular Weight: 39 kDa\nGenBank Accession Number: NM_006383.3\nGene Symbol: CIB2\nGene ID (NCBI): 10518\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: O75838\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886574325929,"sku":"32585-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32585-1-ap","provider":"Iright","version":"1.0","type":"link"}