{"product_id":"proteintech-32649-1-ap","title":"Proteintech, 32649-1-AP, LYVE1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LYVE1 (32649-1-AP) by Proteintech is a Polyclonal antibody targeting LYVE1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n32649-1-AP targets LYVE1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue, bEnd.3 cells,  rat spleen tissue\nPositive IHC detected in: human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLYVE1 is a 322-amino acid type-I integral membrane glycoprotein primarily expressed on lymphatic endothelial cells. LYVE1 is a CD44 homologue. It acts as a receptor and binds to both soluble and immobilized hyaluronan. LYVE1 may function in lymphatic hyaluronan transport and have a role in tumor metastasis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg1615 Product name: Recombinant Human LYVE-1 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-238 aa of NM_006691.4 Sequence: LVQGSLRAEELSIQVSCRIMGITLVSKKANQQLNFTEAKEACRLLGLSLAGKDQVETALKASFETCSYGWVGDGFVVISRISPNPKCGKNGVGVLIWKVPVSRQFAAYCYNSSDTWTNSCIPEIITTKDPIFNTQTATQTTEFIVSDSTYSVASPYSTIPAPTTTPPAPASTSIPRRKKLICVTEVFMETSTMSTETEPFVENKAAFKNEAAGFGGVPT Predict reactive species\nFull Name: lymphatic vessel endothelial hyaluronan receptor 1\nCalculated Molecular Weight: 35kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: NM_006691.4\nGene Symbol: LYVE1\nGene ID (NCBI): 10894\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5Y7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868843298985,"sku":"32649-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32649-1-ap","provider":"Iright","version":"1.0","type":"link"}