{"product_id":"proteintech-32660-1-ap","title":"Proteintech, 32660-1-AP, SLAM\/CD150 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLAM\/CD150 (32660-1-AP) by Proteintech is a Polyclonal antibody targeting SLAM\/CD150 in WB, ELISA applications with reactivity to mouse samples\n32660-1-AP targets SLAM\/CD150 in WB, ELISA applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse spleen tissue, mouse thymus tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSignaling lymphocytic activation molecule (SLAM, also known as SLAMF1 or CD150) is a 70-95 kDa transmembrane glycoprotein that belongs to the immunoglobulin gene superfamily. SLAM is constitutively expressed on peripheral blood memory T-cells, T-cell clones, immature thymocytes and a proportion of B-cells, and is rapidly induced on naive T-cells after activation. SLAM is involved in T cell stimulation and cytokine production, and may play an important role in the regulation of immune responses to pathogens.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Eg2787 Product name: Recombinant Mouse SLAM\/CD150 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 25-242 aa of NM_013730.4 Sequence: TGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSP Predict reactive species\nFull Name: signaling lymphocytic activation molecule family member 1\nCalculated Molecular Weight: 38 kDa\nObserved Molecular Weight: 70-90 kDa\nGenBank Accession Number: NM_013730.4\nGene Symbol: Slamf1\nGene ID (NCBI): 27218\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9QUM4-1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887802831017,"sku":"32660-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32660-1-ap","provider":"Iright","version":"1.0","type":"link"}