{"product_id":"proteintech-32695-1-ap","title":"Proteintech, 32695-1-AP, COPS7B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe COPS7B (32695-1-AP) by Proteintech is a Polyclonal antibody targeting COPS7B in WB, ELISA applications with reactivity to human, mouse, rat samples\n32695-1-AP targets COPS7B in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, human testis tissue,  mouse testis tissue,  rat testis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCOP9 signalosome complex subunit 7b (COPS7B, also known as CSN7B) is a component of the ribo-interactome that interacts with ribosomes to facilitate ribosome biogenesis and mRNA translation initiation (PMID: 27903243). Increased expression of COPS7B mediated by IGF2BP3 elevates the translational efficiency of genes enriched in mRNA translation and ribosome biogenesis pathways, promoting protein synthesis and driving progression in colorectal cancer (PMID: 37560971).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag38543 Product name: Recombinant human COPS7B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 100-264 aa of NM_022730.3 Sequence: TIVSLASRMKCIPYSVLLKDLEMRNLRELEDLIIEAVYTDIIQGKLDQRNQLLEVDFCIGRDIRKKDINNIVKTLHEWCDGCEAVLLGIEQQVLRANQYKENHNRTQQQVEAEVTNIKKTLKATASSSAQEMEQQLAERECPPHAEQRQPTKKMSKVKGLVSSRH* Predict reactive species\nFull Name: COP9 constitutive photomorphogenic homolog subunit 7B (Arabidopsis)\nCalculated Molecular Weight: 30 kDa，264 aa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: NM_022730.3\nGene Symbol: COPS7B\nGene ID (NCBI): 64708\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity Purification\nUNIPROT ID: Q9H9Q2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886810452137,"sku":"32695-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/ar\/products\/proteintech-32695-1-ap","provider":"Iright","version":"1.0","type":"link"}